PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000816.1_g00004.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 997aa    MW: 109445 Da    PI: 5.3366
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000816.1_g00004.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.37.5e-29588639152
                   RWP-RK   1 aekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                              aek+isl++l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Itr_sc000816.1_g00004.1 588 AEKTISLDVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 639
                              589***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.564578659IPR003035RWP-RK domain
PfamPF020426.6E-26591639IPR003035RWP-RK domain
SuperFamilySSF542771.21E-20901988No hitNo description
SMARTSM006664.0E-23902984IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2404.9E-24902983No hitNo description
PROSITE profilePS5174524.764902984IPR000270PB1 domain
PfamPF005641.8E-16903983IPR000270PB1 domain
CDDcd064072.11E-34903983No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 997 aa     Download sequence    Send to blast
MSEPDDEAPK SKEFFSPPRP LPEREPMMMM DLDLDASWTF EQIFAAAASN PNTPFVLSGS  60
DQPFSPLWGF PDDYEDRTAE NAAVGSIRLS DCHRLPPWDP DSVIEGVPGQ DEKRRLPPPF  120
LGLTTKDYLD GSCIIKERMT QALRYFKEST GERVLAQLWA PVKNGGRYIL TTSGQPFVLD  180
PNSNGLHQYR MMSLMYSFSV DGETDGVLGL PGRVFRQKLP EWTPNVQYYS IKEFPRLNHA  240
LNYNVRGTVA LPVFEPSGQS CIGVLELIMT SQKVNYAPEV DKVCKALEAV NLKSSEILDH  300
PSTQICNEGR QHALVEILEI LTVLCETYKL PLAQTWVPCR HRNVLADGGG LKKSCSSFDG  360
SCMGQVCMST TDVAFYVVDA HMWGFREACA EHHLQKGQGV AGRAFASQRS CYCEDITQFC  420
KTEYPLVHYA RMFGLASCFA ICLRSTHTGN DDYIMEFFLP PNGGDYSDQQ ALLDSLLLTL  480
KNHFKSLRVA SGNLLEHEWG SVEIINASVP SVEKKPDLMT ETHRFSPPQP AILPNGQLCP  540
DPLENKQLTP GQNTPNGGTL SEPPEAQNRA TVAVNIEGGK KEKKRGKAEK TISLDVLQQY  600
FAGSLKDAAK SLGVCPTTMK RICRQHGISR WPSRKINKVN RSLSKLKRVI ESVQGADGAP  660
FTLSTIAPNS VPVAVGSISW PTTAIESNCQ NSPPSRPSES PEGKSEFLNH IEHGSHDQAE  720
PSNQILEGQV LGNHELPHQQ NGFAVGEGSN RSRTGSGSRE ESIGTPTSHG SCQASPSPGN  780
EPSPQNELVV SPTRDPAMEA LNTLGIACHQ PAREINLASA FASLDALVAE QFQKPFGGML  840
VEDAGSSHDL RNLCQAGEAQ FDERMPENSL THPPCSDAIP IDHITNAAER VPQHPARPEV  900
TSITIKATYG EDIIRFRLSL GSGIVKLQEE VAKRLKLELG TFEVKYLDDD HEWVLIACDA  960
DLQECIDISR SSGGNITRLL IQDIMPHLGS SCESSGE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006343817.10.0PREDICTED: protein NLP6-like
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLM1AWK00.0M1AWK0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000319450.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52232239
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7